top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|68347846|68390052|+|6|circRNA|LRP5|ENST00000294304.11|2,3,4,5,6,7

LRP5

Open Reading Frame (ORF)

MGRSGVCWSMPPSGGPTAWPWTCRRGSSTGETPRQTRSSLAAPAICQPPGRTAGGRRRSQAGVHHRGQRPGGCGRSGLPVFQGSRVLDRRERGGHQADLPEPDGGRRAERGHLRPGLSRRPRLRLGGQEAVLDGLRDQPHRGGQPQWHIPEGALLAGP

Peptide

RGSSTGETPR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page