top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|67215339|67217884|+|3|circRNA|KDM2A|ENST00000398645.6|7,8,9

KDM2A

Open Reading Frame (ORF)

LELYENWLLSGKQGDIFLGDRVSDCQRIELKQGYTFVIPSGGFH

Peptide

QGYTFVIPSGGFH

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page