top of page

CircRNA

Gene

chr11|66828265|66828943|+|2|rescued|C11orf80|ENST00000527634|99,228|0,450

C11orf80

Open Reading Frame (ORF)

LESGETEFPARISVHSLEETITKPVKSYLTSLRVKTPTKEILDLQHPKRQLTHKSSGPNCTKYFVRSPNTNFFTTAHVR

Peptide

LESGETEFPAR

ORF Found in Long-Read

true

Peptide Length

11

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

Rescued

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page