top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|66624213|66625678|+|1|circRNA|RBM14|ENST00000310137.4|2

RBM14

Open Reading Frame (ORF)

LAWLSSLGTRPRNQGLGIRPSLELVASLPPSTTSRLLATALVALMGKPVSPHHPSLVATAALCAVHLPEPLMWLL

Peptide

LAWLSSLGTRPR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page