top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|6608393|6608967|+|3|circRNA|ILK|ENST00000532063.5|3,4,5

ILK

Open Reading Frame (ORF)

MGQNLNRIPYKDTFWKGTTRTRPPIAVQGRHQCSE

Peptide

TRPPIAVQGR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

6

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page