top of page

CircRNA

Gene

chr11|65132921|65133618|-|3|circRNA|SYVN1|ENST00000294256.12|4,3,2

SYVN1

CircRNA UID

circSYVN1(4,3,2)

Open Reading Frame (ORF)

LERSWYAVTETCLAFTVFRDDFSPRFVALFTLLLFLKCFHWLAEDRVDFVSGPGQCSARQ

Peptide

CFHWLAEDRVDFVSGPGQCSAR

ORF Found in Long-Read

false

Peptide Length

22

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

8

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page