top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|64193077|64194620|+|3|circRNA|STIP1|ENST00000358794.9|2,3,4

STIP1

Open Reading Frame (ORF)

MMPYSATPKLLSWIPTTTCCTATVLLPMPRKETTRRLMRMAARLST

Peptide

MMPYSATPK

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page