top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|46547112|46548500|-|3|circRNA|AMBRA1|NM_017749|4,3,2

AMBRA1

Open Reading Frame (ORF)

LIGHRRTPWCVTFHPTISGLIASGCLDGEVRIWDLHISMRTTYKDLYGLILAASVCWSCYLLLHFLGLV

Peptide

IWDLHISMR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page