top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|32927156|32935435|+|3|circRNA|QSER1|ENST00000399302.6|2,3,4

QSER1

Open Reading Frame (ORF)

LKLAVTVHQIKLIMNLKTWNIYLHFLLMKMILDIVKMLIKASLLP

Peptide

MILDIVKMLIK

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page