top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|20080063|20105727|+|11|circRNA|NAV2|ENST00000360655.8|25,26,27,28,29,30,31,32,33,34,35

NAV2

Open Reading Frame (ORF)

LDSQGLASPQPLPGGSQFLGRHHRKRHCPVCRPPHPQAALLRQRLQHQQCHQPLQRGQQHRE

Peptide

LDSQGLASPQPLPGGSQFLGR

ORF Found in Long-Read

false

Peptide Length

21

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

21

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page