top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|19879868|19892594|+|2|circRNA|NAV2|ENST00000360655.8|5,6

NAV2

Open Reading Frame (ORF)

LQAARPKHAEGQLLLTTDAARALTTMINPNQSPPHPHRQAATRKRSGMETSRPF

Peptide

HAEGQLLLTTDAAR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page