top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|18341260|18341607|+|2|circRNA|GTF2H1|NM_001142307|7,8

GTF2H1

Open Reading Frame (ORF)

MSKNEICRKCSPQHDREGILDTFFPVPLFSQGSAEYRVKGSLCRMCQNR

Peptide

CSPQHDREGILDTFFPVPLFSQGSAEYR

ORF Found in Long-Read

false

Peptide Length

28

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

28

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page