top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|18295019|18306347|-|8|circRNA|HPS5|ENST00000396253.7|13,12,11,10,9,8,7,6

HPS5

Open Reading Frame (ORF)

LENWKQGKRWRIWSLFLSWKMFWGPATSDILCSPRL

Peptide

IWSLFLSWKMFWGPATSDILCSPR

ORF Found in Long-Read

false

Peptide Length

24

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

24

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page