top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|16826119|16841722|-|2|circRNA|PLEKHA7|ENST00000531066.5|10,9

PLEKHA7

Open Reading Frame (ORF)

LSPRPTTQSPVTNVAGWDPDIREIVLIVAMMTLSTSRGRSRRESSTVPRGTHWRASGTGARPGLRTRQPRRMPCLWIYPLAQEASRHSPNGQRRMECCLPHMAQENRMGLVGTSGPFLPGPTLKNTAKGRAIWPRWSTGQGPRKGIAGGCAHGDASAHL

Peptide

EIVLIVAMMTLSTSRGR

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page