top of page

CircRNA

Gene

chr11|133919741|133927091|-|6|circRNA|IGSF9B|ENST00000533871.6|18,17,16,15,14,13

IGSF9B

Open Reading Frame (ORF)

LPPGPSTMASIMGTSAAAALGRWSRPRSTCQKWAAP

Peptide

LPPGPSTMASIMGTSAAAALGR

ORF Found in Long-Read

false

Peptide Length

22

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

22

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

true

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page