top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|121137420|121138022|+|1|circRNA|TECTA|ENST00000392793.5|11

TECTA

Open Reading Frame (ORF)

LRSASHVQRPVRPLPWAPSAWIAALRDVSVMRAMLYWAASVSRGVSVAATLRGTNLPPMRPSGWTWTARSSAIAVAQTTGSTARPFPARMMSTAWRKVACTTAKPAPTPPASSQATATTSPLMASPLTSRPAAHSSCAPQEAGQAQTLSPSLLSQPRMRTGTRHWPCGLSRWT

Peptide

GTNLPPMRPSGWTWTAR

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page