top of page

CircRNA

Gene

chr11|108297286|108304852|+|5|circRNA|ATM|ENST00000278616.8|33,34,35,36,37

ATM

CircRNA UID

circATM(33,34,35,36,37)

Open Reading Frame (ORF)

MIFYSKIQMNHGEICFLHMFRDFSPAVFDTSRKRADPQPLQTWIQIIRKMGLW

Peptide

MIFYSKIQMNHGEICFLHMFR

ORF Found in Long-Read

false

Peptide Length

21

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

21

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page