top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|103303092|103312033|+|4|circRNA|DYNC2H1|ENST00000375735.6|76,77,78,79

DYNC2H1

Open Reading Frame (ORF)

MSLGLLSKLAKKIIHIELMLSSVLHGFMLHVKKEETIFLRTERGVPTASKSQTFIQRDTGN

Peptide

IIHIELMLSSVLHGFMLHVK

ORF Found in Long-Read

false

Peptide Length

20

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

20

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page