top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|99955213|99957205|-|1|circRNA|DNMBP|ENST00000324109.8|4

DNMBP

Open Reading Frame (ORF)

MAFPLQAGCRAEAAGAHGASSHLHVSASSASPHRAGSGTPRAPCFRFRNIPWDKPGP

Peptide

AEAAGAHGASSHLHVSASSASPHRAGSGTPR

ORF Found in Long-Read

false

Peptide Length

31

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

31

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page