top of page

CircRNA

Gene

chr10|96907264|96949295|+|4|circRNA|LCOR|ENST00000540664.5|3,4,5,6

LCOR

CircRNA UID

circLCOR(3,4,5,6)

Open Reading Frame (ORF)

LLLNIPQKIALLRTPASPIAQRTKACRKHLQSPPLPRLQLLRTLCSANFSWLTKTHLWTLLSESLSQNLANKGLKVFLKGCLDLHY

Peptide

IALLRTPASPIAQR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page