top of page

CircRNA

Gene

chr10|95839690|95847706|+|5|circRNA|ENTPD1|ENST00000453258.6|3,4,5,6,7

ENTPD1

Open Reading Frame (ORF)

LKSRVLETINNAIKASWSSSTPVTALTPSVPSMGFSCHHSRGILGMGLCWMRVLLTQVYTSISGQQKRRMTQAWCIK

Peptide

GILGMGLCWMR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAG

Peptide Type

Junction

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page