top of page

CircRNA

Gene

chr10|95058334|95067357|-|3|circRNA|CYP2C8|ENST00000535898.5|4,3,2

CYP2C8

Open Reading Frame (ORF)

LDVNNPRDFIDCFLIKMEQESFPAMERDGRRSGVSPSQPCGILGWGRGALRTVFKRKLTALWRS

Peptide

RSGVSPSQPCGILGWGR

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page