top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|94775057|94820637|+|5|circRNA|RP11-400G3.5|ENST00000464755.1|7,8,9,10,11

RP11-400G3.5

Open Reading Frame (ORF)

LVITAADLLGAGTETTSTTLRYALLLLLKHPEVTALKNLWPCVHSVFWPGTHGGAAWI

Peptide

HPEVTALK

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page