top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|94474667|94511654|+|7|circRNA|TBC1D12|NM_015188|3,4,5,6,7,8,9

TBC1D12

Open Reading Frame (ORF)

LMLVMNMKHERGGPVNHHLSLQDARILNLSRFLPLP

Peptide

LMLVMNMKHER

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page