top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|94030682|94032252|+|1|circRNA|PLCE1|NM_001288989|2

PLCE1

Open Reading Frame (ORF)

MELHRSEEKWSLTALWESNGTPVNSGDKARWEPTSVRSPVVS

Peptide

ARWEPTSVR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page