top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|91994534|92008275|+|4|circRNA|BTAF1|ENST00000265990.10|23,24,25,26

BTAF1

Open Reading Frame (ORF)

MSAELIQLKAKERHFLEQLLDGKKLENYKIPVPINAELRKYQQMENPSWIREIALLKNW

Peptide

YQQMENPSWIR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

6

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page