top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|91994534|91997751|+|3|circRNA|BTAF1|ENST00000265990.10|23,24,25

BTAF1

Open Reading Frame (ORF)

MEQLDVGIVPYIVLLVVPVLGRMSDQTDSVRFMATQCFATLIRLMPLEMENPSWIREIALLKNW

Peptide

FMATQCFATLIRLMPLEMENPSWIR

ORF Found in Long-Read

false

Peptide Length

25

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

8

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page