top of page

CircRNA

Gene

chr10|91939951|91966757|+|12|circRNA|BTAF1|ENST00000265990.10|3,4,5,6,7,8,9,10,11,12,13,14

BTAF1

CircRNA UID

circBTAF1(3,4,5,6,7,8,9,10,11,12,13,14)

Open Reading Frame (ORF)

LAFFASHYIISSKSSIGNSVYVIINTGPGVDIFKECKLGYPDCSRTSC

Peptide

SSIGNSVYVIINTGPGVDIFKECK

ORF Found in Long-Read

false

Peptide Length

24

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

8

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page