top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|86912239|86919469|+|3|circRNA|BMPR1A|NM_004329|8,9,10

BMPR1A

Open Reading Frame (ORF)

MGVAALLTWALLLNSTDIIARASQADVVTIVIWNRMKHLFQLENH

Peptide

ASQADVVTIVIWNR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116,PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page