top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|86890061|86900126|+|4|circRNA|BMPR1A|NM_004329|4,5,6,7

BMPR1A

Open Reading Frame (ORF)

MAGFAHFYGCLHNCYDHLLQLLLLQDRIWIVCFMALG

Peptide

MAGFAHFYGCLHNCYDHLLQLLLLQDR

ORF Found in Long-Read

false

Peptide Length

27

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

25

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page