top of page

CircRNA

Gene

chr10|84176569|84184605|+|1|ciRNA|C10orf99|ENST00000372126.3|2

C10orf99

Open Reading Frame (ORF)

LMAVKAPPARKYCGPEASFRPPSFYASWGHGEAIWEDWGGPVGSLEPERLPRS

Peptide

YCGPEASFRPPSFYASWGHGEAIWEDWGGPVGSLEPER

ORF Found in Long-Read

false

Peptide Length

38

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

38

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page