top of page

CircRNA

Gene

chr10|73516374|73530835|-|7|circRNA|USP54|ENST00000424265.5|12,11,10,9,8,7,6

USP54

Open Reading Frame (ORF)

LNPLHSTGKVYLKHQGGLRRILIIVGSHWMPQRVSCKALGVTTAVAASSLHKKEEALLKNSCSKKRRILLTPPR

Peptide

ILLTPPR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page