top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|73192555|73193593|+|2|circRNA|FAM149B1|NM_173348|4,5

FAM149B1

Open Reading Frame (ORF)

LYPRSPSAVSASYETTLSQERDSTMNSIKMPLKKSRQCSQPLMNSCMSRS

Peptide

SPSAVSASYETTLSQERDSTMNSIK

ORF Found in Long-Read

false

Peptide Length

25

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

21

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page