top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|73068845|73074915|-|4|circRNA|P4HA1|ENST00000307116.6|5,4,3,2

P4HA1

Open Reading Frame (ORF)

MMKIRLGQPKLCYVSRIPTIWIQIPSQRVIFQVCDPVKLNLPR

Peptide

IRLGQPK

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page