top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|69483763|69485160|+|1|new|ENST00000373290|ENST00000373290|1397|0

ENST00000373290

Open Reading Frame (ORF)

LPIKPGLAPLAQWQRGPALLMVVGEGRALPHRPPRQMEVTIWLGQLSHSSCPPAPETGFPGACLSTSTFSQEEGAEA

Peptide

ALPHRPPR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

Novel in Short-Read

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page