top of page

CircRNA

Gene

chr10|63193344|63197563|-|3|circRNA|JMJD1C|NM_001282948|14,13,12

JMJD1C

CircRNA UID

circJMJD1C(14,13,12)

Open Reading Frame (ORF)

LTDLLDAMHTLREKYGIKSHCHCTNKQNLQVGNFPTMNGVSQPKLPGKEQ

Peptide

QNLQVGNFPTMNGVSQPKLPGK

ORF Found in Long-Read

false

Peptide Length

22

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page