top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|5730486|5735546|+|2|circRNA|FAM208B|ENST00000328090.9|11,12

FAM208B

Open Reading Frame (ORF)

LHSLYRKPNWIGKTKKLLFLKMFQCQQMLKGQGNKRNLQSKLFQGLSHL

Peptide

MFQCQQMLKGQGNK

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page