top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|49857305|49934163|-|11|circRNA|PARG|NM_001303486|13,12,11,10,9,8,7,6,5,4,3

PARG

Open Reading Frame (ORF)

LRRKVNPSHRWMWIILKIVVKTQKQMRRQVQVLMNKKMVVPPKQQINLQGSKQETLTLNLGNGTLLRAVKLDYISNLKEERVALE

Peptide

KVNPSHR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

true

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page