top of page

CircRNA

Gene

chr10|413912|423033|-|4|circRNA|DIP2C|ENST00000381496.7|7,6,5,4

DIP2C

CircRNA UID

circDIP2C(7,6,5,4)

Open Reading Frame (ORF)

LAAVAGGRTAEVGHHLAQGALPDHHGHQREAPLHPHLRYLFWLRR

Peptide

EAPLHPHLR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page