top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|413912|423033|-|4|circRNA|DIP2C|ENST00000381496.7|7,6,5,4

DIP2C

Open Reading Frame (ORF)

LAAVAGGRTAEVGHHLAQGALPDHHGHQREAPLHPHLRYLFWLRR

Peptide

LAAVAGGR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page