top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|29550596|29563292|-|4|circRNA|SVIL|ENST00000375400.7|8,7,6,5

SVIL

Open Reading Frame (ORF)

MTCPQQPRVPRPSLSLGETPPSLKCHGPPSTPTAPPCSRQPPGAPPLVTHSYPLRPDPAFRRSSHSKIKNSSLTTKEESMLSF

Peptide

IKNSSLTTK

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

true

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page