top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|17856241|17863682|+|3|circRNA|MRC1|NM_002438|9,10,11

MRC1

Open Reading Frame (ORF)

LDRTFRYTNQRDFSVDHRGRGSVHPLEFRYARMGTGQIGAVSGLLATSAR

Peptide

MGTGQIGAVSGLLATSAR

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page