top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|133283077|133288309|-|5|circRNA|TUBGCP2|ENST00000252936.7|14,13,12,11,10

TUBGCP2

Open Reading Frame (ORF)

LPEGLHAHQPRAAEGLLQAHVCVRHVHQLHAGPSSATSSWTRATSSCTSWTSRRRSSGSRWRTSRPLAWKRSWSWRCA

Peptide

AAEGLLQAHVCVR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page