top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|125988550|126005049|+|5|circRNA|FANK1|ENST00000368693.5|3,4,5,6,7

FANK1

Open Reading Frame (ORF)

MLACYAGHLDVVKYLRRHGASWQARDLGGCTALHWAADGGHCSVIEWMIKDGCEGICNEACC

Peptide

DGCEGICNEACC

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

6

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page