top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|124681606|124682379|-|2|rescued|ENSG00000258539|ENST00000494792|33,141|0,632

ENSG00000258539

Open Reading Frame (ORF)

MAQKMTDGETWTGNALFRLTNRAPASGNACLKRTAHYGTGRQ

Peptide

APASGNACLK

ORF Found in Long-Read

true

Peptide Length

10

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

Rescued

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page