top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|121898840|121902620|-|2|circRNA|ATE1|ENST00000369040.7|5,4

ATE1

Open Reading Frame (ORF)

LSPLRTQSSSRLSASPFLCMSSIKWPYTRIHPMNVGRLRQRG

Peptide

IHPMNVGR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page