top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|119796714|119811955|+|9|circRNA|INPP5F|NM_014937|7,8,9,10,11,12,13,14,15

INPP5F

Open Reading Frame (ORF)

LMMRSSMGAGPSLTVTLDSRCGLLDYPHDPRFCAD

Peptide

LMMRSSMGAGPSLTVTLDSR

ORF Found in Long-Read

false

Peptide Length

20

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page