top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|115120184|115334419|+|18|circRNA|ATRNL1|NM_207303|2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19

ATRNL1

Open Reading Frame (ORF)

MDIALASIIMCANSVKISPQESSVKIVCQVIMEIQPMVDSAQVNRTFWIFNRWPN

Peptide

IVCQVIMEIQPMVDSAQVNR

ORF Found in Long-Read

false

Peptide Length

20

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page