top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|100972528|100973609|+|3|circRNA|SEMA4G|ENST00000519649.5|2,3,4

SEMA4G

Open Reading Frame (ORF)

LGSLPRDAKQMSSKREKQPENGPQKTRTSSTVGGRVTPSVTYNPSRTSQLPLTMEFAFDAERHVIPPSF

Peptide

TRTSSTVGGR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page