top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr10|100495384|100516997|-|18|circRNA|SEC31B|ENST00000370345.7|19,18,17,16,15,14,13,12,11,10,9,8,7,6,5,4,3,2

SEC31B

Open Reading Frame (ORF)

MLKVLLSWANSLPLSPSPGLLWELPSTLKRHHLTDWDPSLLTSGLRAMSVFCHLQDRP

Peptide

HHLTDWDPSLLTSGLR

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page