top of page

CircRNA

Gene

chr1|955922|957273|-|4|circRNA|NOC2L|NM_015658|6,5,4,3

NOC2L

Open Reading Frame (ORF)

MLWLPSASETSLAVSRSCCLERWQRIAAAGVKAVPLSTKTSSLG

Peptide

IAAAGVK

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA,PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page